Loading...
Statistics
Advertisement

naxal.ru - Diese Website steht zum Verkauf! - Informationen zum ...
www.naxal.ru/
Diese Website steht zum Verkauf! naxal.ru ist Ihre erste und beste Informationsquelle über naxal Hier finden Sie auch weitere interessante Links. Wir ...

Naxal.ru

Advertisement
Conversion Technology Metas Server
Naxal.ru is hosted in Germany . Naxal.ru uses HTTPS protocol. Number of used technologies: 6. First technologies: CSS, Html, Html5, Number of used javascripts: 4. First javascripts: Jquery-1.4.2.min.js, Caf.js, Iam.js, Number of used analytics tools: 0. Its server type is: Apache/2.2.22 (Debian).

Technologies in use by Naxal.ru

Technology

Number of occurences: 6
  • CSS
  • Html
  • Html5
  • Javascript
  • Php
  • SVG

Advertisement

Javascripts

Number of occurences: 4
  • jquery-1.4.2.min.js
  • caf.js
  • iam.js

Advertise

Number of occurences: 1
  • Google Adsense

Server Type

  • Apache/2.2.22 (Debian)

Powered by

  • PHP/5.6.25-1~dotdeb.7.1

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Naxal.ru

SSL certificate

    • name: /OU=Domain Control Validated/CN=cc.sedoparking.com
    • subject:
      • OU: Domain Control Validated
      • CN: cc.sedoparking.com
    • hash: 75a61910
    • issuer:
      • C: BE
      • O: GlobalSign nv-sa
      • CN: GlobalSign Domain Validation CA - SHA256 - G2
    • version: 2
    • serialNumber: 1492334156563186506134045474198837599565904
    • validFrom: 151111084540Z
    • validTo: 171111084540Z
    • validFrom_time_t: 1447231540
    • validTo_time_t: 1510389940
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • certificatePolicies: Policy: 2.23.140.1.2.1 CPS: https://www.globalsign.com/repository/
      • subjectAltName: DNS:cc.sedoparking.com
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • crlDistributionPoints: Full Name: URI:http://crl.globalsign.com/gs/gsdomainvalsha2g2.crl
      • authorityInfoAccess: CA Issuers - URI:http://secure.globalsign.com/cacert/gsdomainvalsha2g2r1.crt OCSP - URI:http://ocsp2.globalsign.com/gsdomainvalsha2g2
      • subjectKeyIdentifier: 0E:6F:EB:0F:FC:4B:CA:2F:04:C5:FE:DC:1B:B8:A5:5F:31:E1:C3:6A
      • authorityKeyIdentifier: keyid:EA:4E:7C:D4:80:2D:E5:15:81:86:26:8C:82:6D:C0:98:A4:CF:97:0F

Meta - Naxal.ru

Number of occurences: 5
  • Name:
    Content: 0; URL=http://www.naxal.ru//?gtnjs=1
  • Name: expires
    Content: NOW
  • Name: GOOGLEBOT
    Content: index, follow, all
  • Name: robots
    Content: index, follow, all
  • Name: description
    Content: Diese Website steht zum Verkauf! naxal.ru ist Ihre erste und beste Informationsquelle über naxal Hier finden Sie auch weitere interessante Links. Wir hoffen, dass Sie bei Ihrer Suche erfolgreich sind!

Server / Hosting

  • IP: 82.98.86.169
  • Latitude: 51.30
  • Longitude: 9.49
  • Country: Germany

Rname

  • ns1.poishi.com
  • ns2.poishi.com

Target

  • abuse.poishi.com

HTTP Header Response

HTTP/1.1 200 OK Date: Sat, 15 Oct 2016 21:16:33 GMT Server: Apache/2.2.22 (Debian) X-Powered-By: PHP/5.6.25-1~dotdeb.7.1 Expires: Mon, 26 Jul 1997 05:00:00 GMT Last-Modified: Sat, 15 Oct 2016 21:16:33 GMT Cache-Control: no-store, no-cache, must-revalidate Cache-Control: post-check=0, pre-check=0 Pragma: no-cache Set-Cookie: tu=390198f93de865afba4212991e66fa6a; expires=Tue, 31-Dec-2019 23:00:00 GMT; Max-Age=101267007; path=/; domain=naxal.ru; httponly X-Adblock-Key: MFwwDQYJKoZIhvcNAQEBBQADSwAwSAJBANnylWw2vLY4hUn9w06zQKbhKBfvjFUCsdFlb6TdQhxb9RXWXuI4t31c+o8fYOv/s8q1LGPga3DE1L/tHU4LENMCAwEAAQ==_R3eA/WOKmF5RoSzKaDijUcbTQRs5yuJaEJuV+ZktwW0F0qHE2a/Pfem+qTkxyuURnuH+yqP27uc5Y5RaarYNPQ== Vary: Accept-Encoding Content-Type: text/html; charset=UTF-8 X-Cache: MISS from 150812 X-Cache: MISS from s_wx1202 Transfer-Encoding: chunked Via: 1.1 s_wx1202 (squid/3.5.20) Connection: keep-alive

DNS

host: naxal.ru
  1. class: IN
  2. ttl: 900
  3. type: A
  4. ip: 82.98.86.169
host: naxal.ru
  1. class: IN
  2. ttl: 900
  3. type: NS
  4. target: ns1.poishi.com
host: naxal.ru
  1. class: IN
  2. ttl: 900
  3. type: NS
  4. target: ns2.poishi.com
host: naxal.ru
  1. class: IN
  2. ttl: 900
  3. type: SOA
  4. mname: ns1.poishi.com
  5. rname: abuse.poishi.com
  6. serial: 200710091
  7. refresh: 28800
  8. retry: 7200
  9. expire: 1209600
  10. minimum-ttl: 600

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.axal.ru, www.nnaxal.ru, www.naxal.ru, www.nhaxal.ru, www.haxal.ru, www.njaxal.ru, www.jaxal.ru, www.nkaxal.ru, www.kaxal.ru, www.nlaxal.ru, www.laxal.ru, www.n axal.ru, www. axal.ru, www.nxal.ru, www.naoxal.ru, www.noxal.ru, www.napxal.ru, www.npxal.ru, www.na9xal.ru, www.n9xal.ru, www.naxal.ru, www.nxal.ru, www.naixal.ru, www.nixal.ru, www.nauxal.ru, www.nuxal.ru, www.naal.ru, www.naxqal.ru, www.naqal.ru, www.naxal.ru, www.naal.ru, www.naxaal.ru, www.naaal.ru, www.naxsal.ru, www.nasal.ru, www.naxdal.ru, www.nadal.ru, www.naxeal.ru, www.naeal.ru, www.naxl.ru, www.naxaol.ru, www.naxol.ru, www.naxapl.ru, www.naxpl.ru, www.naxa9l.ru, www.nax9l.ru, www.naxal.ru, www.naxl.ru, www.naxail.ru, www.naxil.ru, www.naxaul.ru, www.naxul.ru, www.naxa.ru, www.naxalu.ru, www.naxau.ru, www.naxal8.ru, www.naxa8.ru, www.naxal9.ru, www.naxa9.ru, www.naxalj.ru, www.naxaj.ru, www.naxal0.ru, www.naxa0.ru, www.naxalm.ru, www.naxam.ru, www.naxalp.ru, www.naxap.ru, www.naxalo.ru, www.naxao.ru,

Other websites we recently analyzed

  1. 介護資格≪おすすめ求人≫
    今から介護資格を取りにいこうと思ってます。
    Osaka (Japan) - 112.78.200.16
    Server software: LiteSpeed
    Technology: CSS, Html
    Number of meta tags: 3
  2. Psychiatry Port Orange, Florida
    Psychiatrist, Psychiatry, Therapy, Counseling, Psychotherapy, Depression, Anxiety, ADHD, Obsessive Compulsive Disorder, Stress Management, OCD, PTSD
    Ashburn (United States) - 54.236.189.61
    G Analytics ID: UA-49148900-1
    Server software: openresty/1.7.4.1
    Technology: CSS, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, Google Analytics
    Number of Javascript: 10
    Number of meta tags: 4
  3. keechains.org
    United States - 208.91.197.27
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  4. kellerwilliamsrealtyservices.com
    Chicago (United States) - 184.154.247.147
    Server software: nginx
    Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery, jQuery UI, Php, Pingback, Shortcodes, Wordpress
    Number of Javascript: 22
    Number of meta tags: 3
  5. Julian Scheffer
    Julian Scheffer - I am currently pursuing a Ph.D. in Social Psychology at the Pennsylvania State University. I completed my undergrad at the University of Toronto where I obtained a Hon. B.Sc in Neuroscience and Psychology.
    San Francisco (United States) - 104.18.48.189
    G Analytics ID: UA-64569494-2
    Server software: cloudflare-nginx
    Technology: CSS, Html, Html5, Javascript, SVG, Google Analytics, Twitter Button
    Number of Javascript: 3
    Number of meta tags: 5
  6. VÃ¥gan Havnevesen KF
    Vågan havnevesens ansvarsområde omfatter hele kommunens kystlinje med tilhørende havner. Innefor havnedistriktet finnes 15 større og mindre havner med Svolvær som hovedhavn for kommunen og regionen. Andre havner med viktighet for kommunen og havnevesenet er: Digermulen, Skrova, Kabelvåg, Henningsvær, Hopen, Kleppstad, Hovsund og Laukvik.Vågan kommune ligger i et av landets viktigste områder for fiskeri og oppdrett, og er også et nasjonalt satsningsområde for turisme. Havnevesenets primære målsetning er å si
    Norway - 213.162.240.23
    Server software: Apache
    Technology: CSS, Html, Javascript, Php, Google Analytics
    Number of Javascript: 13
    Number of meta tags: 4
  7. psicopatologia.es
    Spain - 37.247.121.15
    Server software: Apache
    Technology: Html
  8. Welcome!
    Russian Federation - 193.124.179.237
    Server software: nginx/1.10.1
    Technology: Html, Html5, Javascript
    Number of meta tags: 1
  9. Hudson Valley Dog Walking and Pet Sitting | Serving Orange & Ulster Counties
    Dog walking and pet sitting for Orange and Ulster counties, New York.
    San Francisco (United States) - 207.198.106.171
    Server software: Apache/2.2.25 (Unix) mod_ssl/2.2.25 OpenSSL/1.0.0-fips mod_bwlimited/1.4 PHP/5.2.17
    Technology: CSS, Html, Php
    Number of meta tags: 3
  10. Stambyten och badrumsrenoveringar i Stockholm - Titania
    Vi är specialister på stambyten, renoveringar och ombyggnationer i Stockholm. När Du anlitar oss får Du en totalentreprenör som tar ansvar för hela processen.
    Sweden - 217.114.90.142
    Server software: Microsoft-IIS/5.0
    Technology: CSS, Flexslider, Html, Html5, Javascript, jQuery Colorbox, JW Player, Google Analytics, New Relic, Google +1 Button
    Number of Javascript: 23
    Number of meta tags: 11

Check Other Websites